PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g15123.2.p
Common NameBRADI_1g15123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 713aa    MW: 81302 Da    PI: 8.6064
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g15123.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.13.9e-1043357043374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cAeavs ++ + a+++L++++ ++sp gd  qRla+y++  L+ rla++vs+++++  + + +   +++ l+ l+l + v+P+l+ s+
  Bradi1g15123.2.p 335 TLLINCAEAVSLNNGSVASEILKKIRRHSSPCGDDSQRLAFYLADCLEIRLAGNVSQISQKTITAPID---VAHILKLLHLCYTVCPYLRASY 424
                       68***************************************************888888665555554...9999999999************ PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                        + N++Il+  +g+ rvHiiDf+i  G+QWp+L++++a+R++gpp+lRiTgv+ p++g    e+ ++t  rL ++A+ ++vp+e+++ +++++
  Bradi1g15123.2.p 425 YLSNKTILDVSKGKPRVHIIDFGICFGFQWPSLFEQFANREGGPPKLRITGVEIPQPGfrPDEMNKNTWLRLVEYANMFKVPLEYRL-ISSKW 516
                       *********************************************************9*88888899999****************9.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       e++++e++ ++++E+l+Vn++ ++++l de+ s++s+r++vL++++ ++P+v+++   + +++++ Fl rf ea+++y+alfd l+ + pr++
  Bradi1g15123.2.p 517 EAISIEDFYIQKDEVLVVNCINRMKTLGDETISIDSARNRVLNTIRMMKPTVFIHGVVNGSYSTPFFLPRFKEAMYHYTALFDILDRTTPRDN 609
                       ********************************************************************************************* PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       ++r+++E +l + +i nv+aceg+er+er e+++kW+ r  +a ++++pl+  ++kq ++++r+++ + y v+ee+++lvlgWk+r L+++S 
  Bradi1g15123.2.p 610 KTRMMLEGHLYKFAILNVIACEGSERTERPESYKKWKVRSLRARLEQLPLNPAIVKQTQCMVRQIYHKDYFVDEEDQWLVLGWKGRILYAIST 702
                       ******************************************************************888************************ PP

              GRAS 373 Wr 374
                       W+
  Bradi1g15123.2.p 703 WK 704
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.66307684IPR005202Transcription factor GRAS
PfamPF035141.4E-101335704IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MANRPECHAN SSQEFIQTTT ISNDLELFLH PQSSMRYYPP PSIVSSKDAH VAWSTPYSCI  60
YSPQSYIVSS NVRSDWRGIS AADNPEHPRL NPDTTLSYIE QMLMQDTDDK VRSHHGETAI  120
RTMEEPFYKL LGQKYPVLPE LSPLCRCGRL KNLNGNISKL TGQSCSTCSV NISSSNDHSN  180
ENTQDFQAPW TLSSIVGEAF TQGTERMEIG LNINGLAITK KPSRDNHPLQ ISAQDTMRHA  240
SFEVRGRKGY PGIDGFDLLE ERSNKKFAIF SDELIRNELF DKVLLCSENK LVGEGIVLQG  300
TMPYKCAQKD QGRKSALQKT RGRTQQKKEV VDLGTLLINC AEAVSLNNGS VASEILKKIR  360
RHSSPCGDDS QRLAFYLADC LEIRLAGNVS QISQKTITAP IDVAHILKLL HLCYTVCPYL  420
RASYYLSNKT ILDVSKGKPR VHIIDFGICF GFQWPSLFEQ FANREGGPPK LRITGVEIPQ  480
PGFRPDEMNK NTWLRLVEYA NMFKVPLEYR LISSKWEAIS IEDFYIQKDE VLVVNCINRM  540
KTLGDETISI DSARNRVLNT IRMMKPTVFI HGVVNGSYST PFFLPRFKEA MYHYTALFDI  600
LDRTTPRDNK TRMMLEGHLY KFAILNVIAC EGSERTERPE SYKKWKVRSL RARLEQLPLN  660
PAIVKQTQCM VRQIYHKDYF VDEEDQWLVL GWKGRILYAI STWKPNEKTR RD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-453377048375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229538.20.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0Q3GTT00.0A0A0Q3GTT0_BRADI; Uncharacterized protein
STRINGBRADI1G15123.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Representative plantOGRP1136547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein